PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g048660.1
Common NameMTR_1g048660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 93aa    MW: 10516 Da    PI: 11.1802
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g048660.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.51.3e-121257247
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     ++WT  E++ ++++ k  G+g Wk+I++ +  ++t+ q+ s+ qk+
  Medtr1g048660.1 12 KPWTRTEHKAFLKGLKAVGKGKWKRISKDFVVTKTPTQVASHAQKH 57
                     58******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.306162IPR017930Myb domain
SMARTSM007171.6E-71060IPR001005SANT/Myb domain
PfamPF002494.5E-101257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-101359IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-141359IPR006447Myb domain, plants
SuperFamilySSF466891.05E-131362IPR009057Homeodomain-like
CDDcd001672.75E-71358No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MNQRKPPAPE VKPWTRTEHK AFLKGLKAVG KGKWKRISKD FVVTKTPTQV ASHAQKHFNY  60
RRGTYNNKNR TSVFDMKLEE NENSKATGAS SV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013467286.12e-63MYB-like transcription factor family protein
SwissprotQ8S9H72e-19DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A072VIR92e-63A0A072VIR9_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA10G23084.17e-22(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.14e-23MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]